PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G291100.2
Common NameB456_004G291100, LOC105792999
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 630aa    MW: 68584.4 Da    PI: 6.5132
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G291100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.82.4e-28175229155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ +LH++Fv av+qLG  ++A+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Gorai.004G291100.2 175 KPRVVWSVDLHRKFVAAVNQLGLGDQAVPKKILDLMNVEGLTRENVASHLQKYRL 229
                         79****************************************************8 PP

2Response_reg63.69.8e-22810018109
                         HH.HTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HH CS
        Response_reg  18 le.kegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpe 105
                         l+ + ++ +v+++ ++  al++l+ ++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++ +++ + +  Ga d+l Kp+ +e
  Gorai.004G291100.2   8 LScSIQF-KVTTTNQAIIALKMLRGNKnrYDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSAHSDTKLVMKGITHGACDYLLKPVRIE 96 
                         5556889.9**************655556*******************87754.558********************************** PP

                         HHHH CS
        Response_reg 106 elvk 109
                         el +
  Gorai.004G291100.2  97 ELKN 100
                         *987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004489.1E-151102IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011033.0211106IPR001789Signal transduction response regulator, receiver domain
PIRSFPIRSF0363927.3E-1438629IPR017053Response regulator B-type, plant
PfamPF000724.4E-1813100IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521721.85E-2513112IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.7E-3113113No hitNo description
CDDcd001561.67E-2214105No hitNo description
Gene3DG3DSA:3.40.50.23002.7E-31149155No hitNo description
Gene3DG3DSA:1.10.10.603.3E-30172234IPR009057Homeodomain-like
PROSITE profilePS5129411.775172232IPR017930Myb domain
SuperFamilySSF466892.33E-18173233IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-25175229IPR006447Myb domain, plants
PfamPF002493.3E-7177228IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MPISGSVLSC SIQFKVTTTN QAIIALKMLR GNKNRYDLVI SDVNMPDMDG FKLLELVGLE  60
MDLPVIMLSA HSDTKLVMKG ITHGACDYLL KPVRIEELKN IWQHVVRRKK PDSKDELAAP  120
NHDKSRGGTG EAGQTWVACS SDQKVNKKRK DQSEDEEEET EDNGHENEDS SSQKKPRVVW  180
SVDLHRKFVA AVNQLGLGDQ AVPKKILDLM NVEGLTRENV ASHLQKYRLY LRRLSSVATQ  240
QANMVVALGS RGPSHLRTGS LDGFGDFRSF TGPRRFSSAS LPSYQSRGTF GRLNSSAALT  300
LSGISSGVIQ PGNSVNGLGK IQPVVLPANQ NQNEALFQGI TASIELNQLS QTKSTNHFGE  360
YNCVNERNVF RISSSFPDAR VVVGSSSNSL STASGNALVL HGSTQEVQCS AAFENLPSFG  420
MTSLNRESND LSVRGSFNCL EHGRCSENWQ GTVQLSNFPP SNEQLPSNNL QESIPWRNSS  480
PSNSRIALSS MASSAVLGDS RADMLCKAGL NNSYSHVDSR VSASGSMMDQ NNAVSSNTND  540
VSLFSHLNGE APFAVRHSEG DKSSSDTDLR SNDNFLFLQS KPQNGFSQNN FESLEDIMSP  600
VFKLEQNNET AFMDGGFGFD VAYPLGSCM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-23171235164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012477358.10.0PREDICTED: two-component response regulator ARR12-like isoform X2
SwissprotB8AEH11e-108ORR23_ORYSI; Two-component response regulator ORR23
TrEMBLA0A0D2S7T60.0A0A0D2S7T6_G
STRINGVIT_11s0206g00060.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-97response regulator 12
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]